About Aging Pathway Atlas Searching DB Data Input Gene Ontology

 
Gene ontology search
 
Keyword search
 

 

ID search
 

 

Sequence search
 

Program Database Expect
Or load it from disk   

 
Example
 

Keyword : Apoptosis, inflammatory

Swiss-prot ID : P49786

Sequence
>gi|7429379 MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYV ATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPD HHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDA EGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG IFKITGLGVKGIAPYSYAG
 >gi|20900778 MAEYSSYIRARFSEHIVDFLLVVMDDSKTGQTKVKFVLVDFLIGSGLKTMAIMSYNHLGKNNSQNLSVLL PFRSKERLESVVIKYVPYVGDSKCALDEYTSKLMLGGTNTLVLHDTCEDSFLAAPVMVDLVLLKELCHCV SFFTNLDPEPQGFHTVLSVRSFLFKAPCVPCGSPVVNALFCQHSCIENIFRACVGLPPQHHMLLEHKMER PGPGIKPGEVAAINPLSSKSPYLPPMAATVMPMDNPQALTPELSTG